PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009602362.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family CO-like
Protein Properties Length: 394aa    MW: 44997.5 Da    PI: 6.2055
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009602362.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box29.71.3e-091760340
        zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                    +r C+ + +k+++++C  ++ +lC++C ++ H+       H++v
  XP_009602362.1 17 ARACDSCIRKRARWYCAADDAFLCQSCDSSVHSAnplarrHERV 60
                    578*****************************667888888876 PP

2CCT69.21.1e-23339382144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     Rea++lRYkeKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk++
  XP_009602362.1 339 REARVLRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRT 382
                     9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003365.3E-111562IPR000315B-box-type zinc finger
PROSITE profilePS5011911.0491562IPR000315B-box-type zinc finger
PfamPF006436.6E-81760IPR000315B-box-type zinc finger
CDDcd000212.48E-101862No hitNo description
PROSITE profilePS5101716.003339381IPR010402CCT domain
PfamPF062033.6E-18339381IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MTSSEKKIAN VVGAKTARAC DSCIRKRARW YCAADDAFLC QSCDSSVHSA NPLARRHERV  60
RLKTSSLKSS DEFSNSVSVP SWHRGFTRKA RTPRNGKNSR KVKNPIQLVV PEILSDENSQ  120
DDNEEQLLYR VPILDPFVAD DAIGNEYSKD QMKNDFNDDH MSKFNGMLNI PSEMELAEFA  180
ADVESLLGRR LDDEESFNYM ELGLGFLEKH DDSMGCSLVD EKIKVENEGE MEVVIDRSSY  240
NQVDYSDTFD LKLDCDSPII TLEEDDKGDT KNNKILLNLD YGGVLNAWAD QRSPWTTGER  300
PEVDFNDCWP VCMGNCGKNH LYGDMGTMTG HGPTVDEGRE ARVLRYKEKR RTRLFSKKIR  360
YEVRKLNAEK RPRMKGRFVK RTNFAPTPFP SLNR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1349365RRTRLFSKKIRYEVRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009602362.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16-like
SwissprotQ8RWD05e-97COL16_ARATH; Zinc finger protein CONSTANS-LIKE 16
TrEMBLM1ACX10.0M1ACX1_SOLTU; Uncharacterized protein
STRINGSolyc04g007210.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15392470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.13e-98B-box type zinc finger protein with CCT domain